| O94561 |
| UniProt ID : |
O94561 |
| NCBI Taxonomy : |
284812 |
| Protein names : |
Peroxiredoxin C1773.02c |
| Organism : |
Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm;Nucleus; |
| Length : |
195 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005829 | Cellular Component | cytosol | IDA | | GO:0005634 | Cellular Component | nucleus | IDA | | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | ISO | | GO:0045454 | Biological Process | cell redox homeostasis | ISO | | GO:0042744 | Biological Process | hydrogen peroxide catabolic process | IC | | GO:0019430 | Biological Process | removal of superoxide radicals | IC | |
|
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| Sequences : |
MDAPRRSSRLAAKIANVLDSKGTIIPEAAPVMLKKPAKDESVDSTIQVGDVIPDITLPDEDGTSIRLRDITANKGLVIFAYPKASTPGCTKQGCGFRDNYPKIQASDYEVLGLSFDTSKAQKAFKDKQNFPYHLLSDPKGELIKKLGAEKPGGGKLFRSHWIFEKGTGKCIVKEIDISPLVSVDKAFAVITDSEP |
| Function : | Acts as an alkyl-hydroperoxide reductase in the nucleus. Acts as an antioxidant (By similarity). |