| O82089 |
| UniProt ID : |
O82089 |
| NCBI Taxonomy : |
3702 |
| Protein names : |
Copper transport protein CCH |
| Organism : |
Arabidopsis thaliana |
| Taxonomy : |
Eukaryota |
| Length : |
121 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0048046 | Cellular Component | apoplast | IDA | | GO:0009507 | Cellular Component | chloroplast | IDA | | GO:0016531 | Molecullar Function | copper chaperone activity | ISS | | GO:0006878 | Biological Process | cellular copper ion homeostasis | IMP | | GO:0006825 | Biological Process | copper ion transport | IEA | | GO:0046686 | Biological Process | response to cadmium ion | IEP | | GO:0009651 | Biological Process | response to salt stress | IEP | |
|
| Catalytic activity : | Binds 1 copper ion per subunit (By similarity). |
| SWISS-MODEL Repository : | O82089 |
| Sequences : |
MAQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTGKKTSYWPVEAEAEPKAEADPKVETVTETKTEAETKTEAKVDAKADVEPKAAEAETKPSQV |
| Function : | Involved in copper homeostasis. Can complement the yeast mutants atx1 and sod1. |