| O74887 |
| UniProt ID : |
O74887 |
| NCBI Taxonomy : |
284812 |
| Protein names : |
Peroxiredoxin tpx1 |
| Organism : |
Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm;Nucleus; |
| Length : |
192 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005829 | Cellular Component | cytosol | IDA | | GO:0005634 | Cellular Component | nucleus | IDA | | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | TAS | | GO:0045454 | Biological Process | cell redox homeostasis | IMP | | GO:0042744 | Biological Process | hydrogen peroxide catabolic process | IMP | | GO:0043433 | Biological Process | negative regulation of sequence-specific DNA binding transcription factor activity | IMP | | GO:0006457 | Biological Process | protein folding | ISO | | GO:0019430 | Biological Process | removal of superoxide radicals | IC | |
|
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | O74887 |
| Sequences : |
MSLQIGKPAPDFKGTAVVNGAFEEIKLADYKGKWVFLGFYPLDFTFVCPTEIVAFSEAASKFAERNAQVILTSTDSEYSHLAFINTPRKEGGLGGINIPLLADPSHKVSRDYGVLIEDAGVAFRGLFLIDPKGVLRQITINDLPVGRSVDEALRLLDAFQFVEEHGEVCPANWHKGSDTIDTKNPEKYFSKH |
| Function : | Physiologically important antioxidant which constitutes an enzymatic defense against sulfur-containing radicals. Can provide protection against a thiol-containing oxidation system but not against an oxidation system without thiol. Required for the peroxide-induced activation of pap1 via its oxidation and for the nuclear accumulation of pap1. Required also for activation of sty1. Reduced by srx1 and this regulation acts as a molecular switch controlling the transcriptional response to hydrogen peroxide. |