| O73872 |
| UniProt ID : |
O73872 |
| NCBI Taxonomy : |
7955 |
| Protein names : |
Superoxide dismutase [Cu-Zn] |
| Organism : |
Danio rerio |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
154 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005829 | Cellular Component | cytosol | IBA | | GO:0005739 | Cellular Component | mitochondrion | IBA | | GO:0005634 | Cellular Component | nucleus | IBA | | GO:0005507 | Molecullar Function | copper ion binding | IBA | | GO:0004784 | Molecullar Function | superoxide dismutase activity | IDA | | GO:0008270 | Molecullar Function | zinc ion binding | IBA | | GO:0070050 | Biological Process | neuron cellular homeostasis | IMP | | GO:0019430 | Biological Process | removal of superoxide radicals | IBA | | GO:0010038 | Biological Process | response to metal ion | IDA | | GO:0051597 | Biological Process | response to methylmercury | IDA | | GO:0009410 | Biological Process | response to xenobiotic stimulus | IDA | |
|
| Catalytic activity : | 2 superoxide + 2 H+ = O2 + H2O2. |
| SWISS-MODEL Repository : | O73872 |
| Sequences : |
MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ |
| Function : | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. |