| O69649 |
| UniProt ID : |
O69649 |
| NCBI Taxonomy : |
1773 |
| Protein names : |
Transcriptional regulator WhiB4 |
| Organism : |
Mycobacterium tuberculosis |
| Taxonomy : |
Bacteria |
| Subcellular locations : | Cytoplasm; |
| Length : |
118 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005618 | Cellular Component | cell wall | IDA | | GO:0005737 | Cellular Component | cytoplasm | IEA | | GO:0051539 | Molecullar Function | 4 iron, 4 sulfur cluster binding | IDA | | GO:0035731 | Molecullar Function | dinitrosyl-iron complex binding | IEA | | GO:0003677 | Molecullar Function | DNA binding | IDA | | GO:0046872 | Molecullar Function | metal ion binding | IEA | | GO:0047134 | Molecullar Function | protein-disulfide reductase activity | IDA | | GO:0090034 | Biological Process | regulation of chaperone-mediated protein complex assembly | IDA | | GO:0006355 | Biological Process | regulation of transcription, DNA-dependent | IEA | | GO:0006351 | Biological Process | transcription, DNA-dependent | IEA | |
| Sequences : |
MSGTRPAARRTNLTAAQNVVRSVDAEERIAWVSKALCRTTDPDELFVRGAAQRKAAVICRHCPVMQECAADALDNKVEFGVWGGMTERQRRALLKQHPEVVSWSDYLEKRKRRTGTAG |
| Function : | Redox-responsive transcriptional regulator that regulates a set of genes involved in protection against environmental stresses encountered during infection. The loss of the O(2) and NO-responsive 4Fe-4S cluster and subsequent redox modifications of Cys residue thiols (possibly by disulfide bond formation) may activate its role in gene regulation. The thiol-oxidized apo-form binds in a sequence non-specific manner to GC-rich DNA, probably in the minor groove. Represses transcription of a number of genes including itself. The reduced apo-form and holo-form do not bind DNA. The apo-form can act as protein disulfide reductase. |