show

O69649

UniProt ID :

O69649

NCBI Taxonomy :

1773

Protein names :

Transcriptional regulator WhiB4

Organism :

Mycobacterium tuberculosis

Taxonomy :

Bacteria

Subcellular locations :

Cytoplasm;

Length :

118

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0005618	Cellular Component	cell wall	IDA
GO:0005737	Cellular Component	cytoplasm	IEA
GO:0051539	Molecullar Function	4 iron, 4 sulfur cluster binding	IDA
GO:0035731	Molecullar Function	dinitrosyl-iron complex binding	IEA
GO:0003677	Molecullar Function	DNA binding	IDA
GO:0046872	Molecullar Function	metal ion binding	IEA
GO:0047134	Molecullar Function	protein-disulfide reductase activity	IDA
GO:0090034	Biological Process	regulation of chaperone-mediated protein complex assembly	IDA
GO:0006355	Biological Process	regulation of transcription, DNA-dependent	IEA
GO:0006351	Biological Process	transcription, DNA-dependent	IEA

Sequences :

MSGTRPAARRTNLTAAQNVVRSVDAEERIAWVSKALCRTTDPDELFVRGAAQRKAAVICRHCPVMQECAADALDNKVEFGVWGGMTERQRRALLKQHPEVVSWSDYLEKRKRRTGTAG

Function :

Redox-responsive transcriptional regulator that regulates a set of genes involved in protection against environmental stresses encountered during infection. The loss of the O(2) and NO-responsive 4Fe-4S cluster and subsequent redox modifications of Cys residue thiols (possibly by disulfide bond formation) may activate its role in gene regulation. The thiol-oxidized apo-form binds in a sequence non-specific manner to GC-rich DNA, probably in the minor groove. Represses transcription of a number of genes including itself. The reduced apo-form and holo-form do not bind DNA. The apo-form can act as protein disulfide reductase.