A2SZW8 |
UniProt ID : |
A2SZW8 |
NCBI Taxonomy : |
4577 |
Protein names : |
1-Cys peroxiredoxin PER1 |
Organism : |
Zea mays |
Taxonomy : |
Eukaryota |
Subcellular locations : | Nucleus; |
Length : |
229 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005634 | Cellular Component | nucleus | IEA | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | IEA | GO:0010231 | Biological Process | maintenance of seed dormancy | IEA | GO:0009269 | Biological Process | response to desiccation | IEA | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
Sequences : |
MPGLTIGDTVPNLELDSTHGKIRIHDYVGDGYAIIFSHPADFTPVCTTEMAAMAGYAKEFEKRGVKLLGISCDDVESHRQWTKDVEAYGGKQQQQQATTTKVTFPILADPARDAIRQLNMVDPDEKDAAGRSMPSRALHVVGPDKAVKLSFLYPATTGRNMDEVLRAVDSLLTAAKHGGKVATPANWKPGECAVIAPGVSDEEARKMFPQGFETADLPSKKGYLRFTKV |
Function : | Antioxidant protein that seems to contribute to the inhibition of germination during stress (By similarity). |