| O59858 |
| UniProt ID : |
O59858 |
| NCBI Taxonomy : |
284812 |
| Protein names : |
Glutathione peroxidase |
| Organism : |
Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Taxonomy : |
Eukaryota |
| Length : |
158 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005829 | Cellular Component | cytosol | IDA | | GO:0005634 | Cellular Component | nucleus | IDA | | GO:0004602 | Molecullar Function | glutathione peroxidase activity | IEA | | GO:0034605 | Biological Process | cellular response to heat | IEP | | GO:0070301 | Biological Process | cellular response to hydrogen peroxide | IGI | | GO:0071470 | Biological Process | cellular response to osmotic stress | IEP | | GO:0019430 | Biological Process | removal of superoxide radicals | IC | | GO:0006790 | Biological Process | sulfur compound metabolic process | NAS | |
|
| Catalytic activity : | 2 glutathione + H2O2 = glutathione disulfide + 2 H2O. |
| Sequences : |
MSHFYDLAPKDKDGNPFPFSNLKGKVVLVVNTASKCGFTPQYKGLEALYQKYKDRGFIILGFPCNQFGNQEPGSDEEIAQFCQKNYGVTFPVLAKINVNGDNVDPVYQFLKSQKKQLGLERIKWNFEKFLVNRQGQVIERYSSISKPEHLENDIESVL |
| Function : | Constitutes a glutathione peroxidase-like protective system against oxidative stresses. Acts as a scavenger of H(2)O(2). |