O55234
UniProt ID : O55234
NCBI Taxonomy : 10090
Protein names : Proteasome subunit beta type-5
Organism : Mus musculus
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;Nucleus;
Length : 264
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005829Cellular ComponentcytosolTAS
GO:0005634Cellular ComponentnucleusIEA
GO:0005839Cellular Componentproteasome core complexIDA
GO:0008233Molecullar Functionpeptidase activityIDA
GO:0004298Molecullar Functionthreonine-type endopeptidase activityIEA
GO:0043161Biological Processproteasomal ubiquitin-dependent protein catabolic processIDA
GO:0006979Biological Processresponse to oxidative stressIDA
Catalytic activity :Cleavage of peptide bonds with very broad specificity.
SWISS-MODEL Repository :O55234
Sequences : MALASVLQRPMPVNQHGFFGLGGGADLLDLGPGSPGDGLSLAAPSWGVPEEPRIEMLHGTTTLAFKFLHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLKVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYSSVSVP
Function :The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This unit is responsible of the chymotrypsin-like activity of the proteasome and is one of the principal target of the proteasome inhibitor bortezomib (By similarity). Plays a role in the protection against oxidative damage through the Nrf2-ARE pathway.