| O55234 |
| UniProt ID : |
O55234 |
| NCBI Taxonomy : |
10090 |
| Protein names : |
Proteasome subunit beta type-5 |
| Organism : |
Mus musculus |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm;Nucleus; |
| Length : |
264 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005829 | Cellular Component | cytosol | TAS | | GO:0005634 | Cellular Component | nucleus | IEA | | GO:0005839 | Cellular Component | proteasome core complex | IDA | | GO:0008233 | Molecullar Function | peptidase activity | IDA | | GO:0004298 | Molecullar Function | threonine-type endopeptidase activity | IEA | | GO:0043161 | Biological Process | proteasomal ubiquitin-dependent protein catabolic process | IDA | | GO:0006979 | Biological Process | response to oxidative stress | IDA | |
| Catalytic activity : | Cleavage of peptide bonds with very broad specificity. |
| SWISS-MODEL Repository : | O55234 |
| Sequences : |
MALASVLQRPMPVNQHGFFGLGGGADLLDLGPGSPGDGLSLAAPSWGVPEEPRIEMLHGTTTLAFKFLHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLKVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYSSVSVP |
| Function : | The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This unit is responsible of the chymotrypsin-like activity of the proteasome and is one of the principal target of the proteasome inhibitor bortezomib (By similarity). Plays a role in the protection against oxidative damage through the Nrf2-ARE pathway. |